General Information

  • ID:  hor006975
  • Uniprot ID:  P21741??22-143)
  • Protein name:  Midkine
  • Gene name:  ADCYAP1
  • Organism:  Homo sapiens
  • Family:  Pleiotrophin family
  • Source:  Animal
  • Expression:  Expressed in various tumor cell lines. In insulinoma tissue predominantly expressed in precancerous lesions.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eukaryota; Opisthokonta; Metazoa; Eumetazoa; Bilateria; Deuterostomia; Chordata; Craniata; Vertebrata; Gnathostomata (jawed vertebrates); Teleostomi; Euteleostomi; Sarcopterygii; Dipnotetrapodomorpha; Tetrapoda; Amniota; Mammalia; Theria; Eutheria; Boreoeutheria; Euarchontoglires; Primates; Haplorrhini; Simiiformes; Catarrhini; Hominoidea (apes); Hominidae (great apes); Homininae; Homo; Homo sapiens (Human)
  • GO MF:  GO:0005576 extracellular region
  • GO BP:  GO:0008083 growth factor activity; GO:0035374 chondroitin sulfate binding; GO:0008201 heparin binding; GO:1904399 heparan sulfate binding
  • GO CC:  GO:0002232 leukocyte chemotaxis involved in inflammatory response; GO:0032735 positive regulation of interleukin-12 production; GO:0010838 positive regulation of keratinocyte proliferation; GO:1904996 positive regulation of leukocyte adhesion to vascular endothelial cell; GO:1903039 positive regulation of leukocyte cell-cell adhesion; GO:0002690 positive regulation of leukocyte chemotaxis; GO:0010759 positive regulation of macrophage chemotaxis; GO:2000179 positive regulation of neural precursor cell proliferation; GO:2001224 positive regulation of neuron migration; GO:0010976 positive regulation of neuron projection development; GO:0090023 positive regulation of neutrophil chemotaxis; GO:2000391 positive regulation of neutrophil extravasation; GO:0048714 positive regulation of oligodendrocyte differentiation; GO:0071673 positive regulation of smooth muscle cell chemotaxis; GO:1900026 positive regulation of substrate adhesion-dependent cell spreading; GO:0045582 positive regulation of

Sequence Information

  • Sequence:  AKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
  • Length:  122
  • Propeptide:  MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
  • Signal peptide:  MQHRGFLLLTLLALLALTSA
  • Modification:  T32 Sulfocysteine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    NA

Physical Information

Mass: Formula:
Absent amino acids: Common amino acids:
pI: Basic residues:
Polar residues: Hydrophobic residues:
Hydrophobicity: Boman Index:
Half-Life: Half-Life Yeast:
Half-Life E.Coli: Aliphatic Index
Instability Index: Extinction Coefficient cystines:
Absorbance 280nm:

Literature

  • PubMed ID:  NA
  • Title:  NA